SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290138|ref|YP_001736954.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290138|ref|YP_001736954.1|
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.43e-24
Family Ferredoxin domains from multidomain proteins 0.07
Further Details:      
 
Domain Number 2 Region: 16-48,107-279
Classification Level Classification E-value
Superfamily Radical SAM enzymes 4.51e-17
Family MoCo biosynthesis proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290138|ref|YP_001736954.1|
Sequence length 299
Comment glycyl-radical activating family protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSGMIFDIQRFAIHDGPGIRTNVFLKGCPLRCWWCQNPEGISPKPQIMYFEYKCLHCHLC
VDVCPLQAIRIDKGDVHIIDRELCDACGKCSDNCPSNALKLVGREYSVEEVMEEIRKDVT
FFDSSGGGVTFTGGEPFFQPLFLKGLLEACKAEGIHTVVETSGFVSREILRKLMQYIDLF
YHDIKLFDDESSSLYTGVPSKPILDNMRFLSESKRNMVIRFPVIPTITDTEENIRGIAGF
LSTLRVEEIHLLPFHDVAEKYARLGMPYKMRVHEAPSRERLKEIKEVFEGIGLKVVLYG
Download sequence
Identical sequences B1L492
gi|170290138|ref|YP_001736954.1| 374847.Kcr_0518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]