SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290183|ref|YP_001736999.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290183|ref|YP_001736999.1|
Domain Number 1 Region: 5-117,220-419
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.35e-105
Family Substrate-binding domain of HMG-CoA reductase 0.000000138
Further Details:      
 
Domain Number 2 Region: 109-216
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 8.89e-31
Family NAD-binding domain of HMG-CoA reductase 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290183|ref|YP_001736999.1|
Sequence length 423
Comment hydroxymethylglutaryl-CoA reductase, degradative [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRTSRISGFYNLPMDERLKIVREFAGLTDEEVEVLREGKLPREVADHMIENVIGLYSLPF
AIATNFLINGKDYLIPMVIEEPSVVAAASNAAKMARDSGGFEAEATDSIMISQIQVVKVP
DLEEAIRRIMAEKDKLIAAANEMDPLLTRLGGGARDLEVRVVGTEAGPMLIVHLLVDTLD
AMGANTVNTMAEGLAPTIERLTGGKVYLRIISNLADRRLARAKAKFSKAAIGGEEVVEGI
MWAYRFAKHDPYRAATHNKGIMNGIIAVALATGQDTRALEAGAHSYAARSGKYTTLTNYW
VDDNGDLWGSIELPLAVGTVGGVVRVHPIAKIALKILGVEKARELAMIMASVGLAQNFAA
LRALATEGIQAGHMKLHARNIAMSVGASPSEIDEVVERMIRERKINVERAKQILEEMRSG
KKA
Download sequence
Identical sequences B1L4D7
gi|170290183|ref|YP_001736999.1| 374847.Kcr_0563 WP_012309213.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]