SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290184|ref|YP_001737000.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290184|ref|YP_001737000.1|
Domain Number 1 Region: 43-137
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000034
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 
Domain Number 2 Region: 183-268
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000109
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290184|ref|YP_001737000.1|
Sequence length 271
Comment DMT family permease [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MLALAAAIFAGCVWGITPSLYAQASREGGSARANFWKSLGALSVLLLLYLSNFELPSRVA
MIYIILNAALGTGIADYSFLKSIAIIGPSRATPIGFTYLIWTAILPSIMIGEPFSAFVLL
GAALAFLGIWLISRGSGEWKMRGIVLSLIASIGWTLSPIAAKQALNYVSEVTLATWNSII
VASLYLMLSLPSPRVRGQGKAALGGMIGVGISLPLYFYAVRELGVALASLTTALAPPVSQ
IASALSGNKLNRNEVIGTILITAGIIIAISI
Download sequence
Identical sequences B1L4D8
374847.Kcr_0564 WP_012309214.1.97847 gi|170290184|ref|YP_001737000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]