SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290330|ref|YP_001737146.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290330|ref|YP_001737146.1|
Domain Number 1 Region: 6-72
Classification Level Classification E-value
Superfamily Homeodomain-like 2.42e-22
Family Alr1493-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290330|ref|YP_001737146.1|
Sequence length 88
Comment hypothetical protein Kcr_0713 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MFDKKCIVMQELLKRIVIDPEVMAGKPVIRGTRITVDLVLELLAAGMSPEEISQDYRISI
EDIRAVLLYAARGSHLDFPGLRSSGRSF
Download sequence
Identical sequences B1L4T4
gi|170290330|ref|YP_001737146.1| 374847.Kcr_0713 WP_012309360.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]