SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290535|ref|YP_001737351.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290535|ref|YP_001737351.1|
Domain Number 1 Region: 16-259
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.91e-57
Family Alanine racemase-like, N-terminal domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 231-377
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.09e-48
Family Eukaryotic ODC-like 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290535|ref|YP_001737351.1|
Sequence length 383
Comment diaminopimelate decarboxylase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRVNGVDLSEIAELFGTPTYVIDLDRVKENYLRLDKAIKCPHVIAYAYKANHEPELVKLL
AKLGSGATVPSAFGVILARISGVPPEKTVLVGPSPSRGDLIEAMDFGAIISIESHSQANA
LRSIGRANVMVRVNPGVGAGAYPGLVTGGKRSKFGLPPEEALSLFNSLKKDMRALGFHTH
IGSQIFSTDPFRAALDVIKGLAERVGGVEIVDLGGGLGVPYSNESPFPLEEYAELVCERV
REMGTKLFLETGRYIVADAGYLLSRVNYVKEVGGEKWLLIDAGMNDLIRPALYGARHEII
CEGEGRERVLVAGPVCESSDFFGEYELPKLKEGDLIAFKNAGAYGFSMASRYNLRPLPAV
VGIEGGRFRLLRPREDFCRAVFG
Download sequence
Identical sequences B1L5D9
gi|170290535|ref|YP_001737351.1| WP_012309565.1.97847 374847.Kcr_0922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]