SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290555|ref|YP_001737371.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290555|ref|YP_001737371.1|
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.07e-63
Family FAD-linked oxidases, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 223-460
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.13e-56
Family Vanillyl-alcohol oxidase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290555|ref|YP_001737371.1|
Sequence length 461
Comment FAD linked oxidase domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSYARVLTELGKRIGKEKIFTEPEELYSYGVDAYTEFKQPPAAVVRASSEEDVRAVLELA
NRERVPVVPRGSGTSLSGGSVPAVPGAIVLDLTPMNKIEVNIDDGYVMAEAGATVLEVDK
ACRSYGFFFPPDPASSRIATIGGSLAENAGGLRGAKFGVMKNWVLAMEVILPGGKKVRIG
EPVYKWRWGPDLMSLFIGSEGTLGVITRAWLKIYPLPEKVVRVLGVFDRIEDAGKAISQI
RRRGYVPMILELLDRETIEIVNESLGYNIEVAEGMVMADVDGPRESVWRIAREVESVMKD
CGGRTRASDDPEEMEQLYLARQGAYAAVTRAYPGVLLEDITVPLSKLMEALRELDRMRKE
YGLKMPVFGHAGDGNLHPNICFDPRDEEQLRKARELFVKTGQLAIKLGGAISGEHGIGLA
KKELFLEEIKAVRGEGYVEMVKMIKQLLDPNGIMNPGKIFF
Download sequence
Identical sequences B1L5F9
374847.Kcr_0942 WP_012309585.1.97847 gi|170290555|ref|YP_001737371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]