SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290607|ref|YP_001737423.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290607|ref|YP_001737423.1|
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-26
Family GHMP Kinase, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 161-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.88e-17
Family Homoserine kinase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290607|ref|YP_001737423.1|
Sequence length 297
Comment homoserine kinase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRAFCSSANLGPGYDIVGLALNAFHDIVEVELVKGDGRAEVVDVRGPYSNSIPLGERNSA
AEAARAALKLAEQRLDAKIRIWKGVPPRRGLGSSGASAAATVRAIDILLGGVLKDEELVK
AASEGERISSGSAHPDNVAPSLFGGLVVIGREVLKFKPDFEFLLAIPWIDVPENKTEYMR
NLIPKEVPLDKFSKHCLHLSHLMLGIALNDARIFGEGMNYSFIDECRSRSIPGFDELRRR
ALENGALGVSISGAGPSILILCEDCPRVSRVLRDEFKRIGVPATILEASPAEGASAL
Download sequence
Identical sequences B1L5L1
WP_012309637.1.97847 374847.Kcr_0994 gi|170290607|ref|YP_001737423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]