SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290609|ref|YP_001737425.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290609|ref|YP_001737425.1|
Domain Number 1 Region: 89-218
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 6.87e-40
Family CTP-dependent riboflavin kinase-like 0.00021
Further Details:      
 
Domain Number 2 Region: 15-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000806
Family MarR-like transcriptional regulators 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290609|ref|YP_001737425.1|
Sequence length 222
Comment riboflavin/FAD biosynthetic operon transcriptional regulator [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MADRMDPFVTYLIVTLALLGATKRPVKVTELGKHMGVSRATLSRWVSRAEELGFIKVSSK
KVQFILLSDKSLDFLLSLKESLEGVEWGEIVIMGEVFSGMGEGAYYMSRKGYSSAFAKMI
GYEPYPGTLNLRVSAEDTRKIDDWRRRVMPKVVQGFSEEGRTFGEVEVYPVKINSEIEAY
SIFPRRRHYGFDVLEIIHKENLRKLLGLKDGDFIAITLKNWS
Download sequence
Identical sequences B1L5L3
gi|170290609|ref|YP_001737425.1| 374847.Kcr_0996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]