SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290624|ref|YP_001737440.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290624|ref|YP_001737440.1|
Domain Number 1 Region: 5-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.66e-33
Family Extended AAA-ATPase domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|170290624|ref|YP_001737440.1|
Domain Number - Region: 221-306
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0493
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290624|ref|YP_001737440.1|
Sequence length 382
Comment DNA replication ATPase HolB large subunit [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MKEGKKVKPLLIVGPPGTGKTSAAHAIANELNYDAIEVNASDLRDRTHLQYIVESSGAVS
LLSGKRRLIILDEIDALPGEGHAIASLVKELISKGIPIVMTANDPYERHLYEIRNLSMMV
KFSRVRWQSVVSVLKDICRKEGLSVPEEVLNKIAKSCQGDLRAAINDLEGLVKGSAELLK
YIGEKYGKRDIETDVFKVLSSIFYGENCYPAYLSSLNLDMDPDMLFRWVEENVAHVYSGR
SLAKAYEMLSLADIMRGRIIRTNNWRFLAYYTQFMTFGVCAAKEGRPEGEKLRPPSLIKQ
LSATKELRSKTKEFLEKIAKRIHVSTAVVRMELIPLLIADAKAGGKLIRQLGRELGIRES
DMREILSDIEEVYKLEAGGKGA
Download sequence
Identical sequences B1L5M8
gi|170290624|ref|YP_001737440.1| 374847.Kcr_1011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]