SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290657|ref|YP_001737473.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290657|ref|YP_001737473.1|
Domain Number 1 Region: 11-104
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000837
Family BAR domain 0.023
Further Details:      
 
Weak hits

Sequence:  gi|170290657|ref|YP_001737473.1|
Domain Number - Region: 153-236
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000471
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290657|ref|YP_001737473.1|
Sequence length 300
Comment hypothetical protein Kcr_1044 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MTVLNESVGSLRQRENELRQMLSKLKEERRSLIEELKQLRAKRFELIDKVRKERESFREA
VERKRKMQDDLERIRNERREALERFKEVRDEVIKLKEEYKYLVSSVGIPEKVLRRRIARL
ERRIETSPLNRDQERDIVMQISQYEAMLQNLNRAKSLKRKILELMTEMEKWRFFVRDAGE
RIGKIKEELNKVYDEITSRKEALEKMNKEIDELTEEIKKRSERVDKLSEEIEKIRADMMG
IQEEIKKRFEATLASSKEAEKKIKEKLAEEALEKYRGGEKLSIEELKLLIEMGLLEKPPS
Download sequence
Identical sequences B1L5R1
WP_012309687.1.97847 gi|170290657|ref|YP_001737473.1| 374847.Kcr_1044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]