SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290680|ref|YP_001737496.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290680|ref|YP_001737496.1|
Domain Number 1 Region: 173-289
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8.84e-29
Family Mevalonate kinase 0.01
Further Details:      
 
Domain Number 2 Region: 2-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-28
Family GHMP Kinase, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290680|ref|YP_001737496.1|
Sequence length 312
Comment mevalonate kinase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRVRASAPSQAFLLGEHAVLYGSPALALSVDKRSHVEASPLPEGEIMIESELGVYKEGSS
YNEDLVKLAEGVKELFNKYGIRSGVHLRIRSEVPASSGMASSASVAAAISKSIDALFNLG
MSESELLDAVYTFERIIHGRASKTGPACAVLGGVIWVEWSDGEMRATSLGHREVPVAIAC
TGEPSRTKEMVERVSKLREAFPEVHEGIVRTISDLVFKGREALESGDFRTLGSLMNINQG
LLYSLGVSSFAIERIIWEARMKGALGAKLSGAGGGGCVVILHEAPEEVASNLTSASISFP
ARVSRRGVVLEP
Download sequence
Identical sequences B1L5T4
374847.Kcr_1067 gi|170290680|ref|YP_001737496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]