SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290683|ref|YP_001737499.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290683|ref|YP_001737499.1|
Domain Number 1 Region: 147-371
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 7.33e-69
Family Creatinase/aminopeptidase 0.00000348
Further Details:      
 
Domain Number 2 Region: 2-145
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000000000209
Family Creatinase/prolidase N-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290683|ref|YP_001737499.1|
Sequence length 374
Comment Xaa-Pro aminopeptidase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MYPKEELESRIRRLRRWMARRDVDLSLFASGPNMLYLSGTMEAELLAVPLDGEPYLIARY
AFGDEIARERSPFHVEVFKPYFGTNRKEVEEPNPFKVLLNTEKLRRVAIDFSGRKELVER
MRKVFRRGKKSVATIDAREQLNRMRSVKSEYEIGLMKESASISIKALDSVEIAPRMSEVE
VANRLEFKMRELGADGSSFPTIVASGMNSFNAHHIPSERRISEGDILLIDFGAKYKGYCS
DITRTYFIGTPPSEFMERYEAVLNAQMRAMEYMRQGVAFERPDIEARKVLKEAGLLEYFV
HSLGHGVGLEIHEDIRLLVGRGGLMEEGMTVTDEPGIYIRGWGGIRIEDTVLVSKSKGIA
LTERLPKDPDFLRR
Download sequence
Identical sequences B1L5T7
WP_012309713.1.97847 374847.Kcr_1070 gi|170290683|ref|YP_001737499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]