SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290796|ref|YP_001737612.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290796|ref|YP_001737612.1|
Domain Number 1 Region: 93-192
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 2.35e-22
Family Ribosomal protein S3 C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 12-101
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0000000000000012
Family Prokaryotic type KH domain (KH-domain type II) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290796|ref|YP_001737612.1|
Sequence length 251
Comment 30S ribosomal protein S3 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSSAKSMPIYKKFVQEGIVKYKLHEFMEKISDKAGFHGVEISSTPIRDIITVYVESPGVM
IGRGGRTSKRISDILKEELGIQNPYIQAKKVDKPFLSTRIVASYIARRIAKGERYKKVAY
SALGRVMAEGAKGVEIRLSGKFGSQRAREERFREGVIYRCGQDYIENVEYAVKHVLMPQG
MIGVRVRIVKPGVRGPDAVVIKEDEIERIRERIKSEMESLSESEVVEIPEELEGELEVAG
EVKEDESEQAR
Download sequence
Identical sequences B1L650
gi|170290796|ref|YP_001737612.1| WP_012309826.1.97847 374847.Kcr_1183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]