SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290847|ref|YP_001737663.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290847|ref|YP_001737663.1|
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily GlnB-like 6.3e-35
Family Divalent ion tolerance proteins CutA (CutA1) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290847|ref|YP_001737663.1|
Sequence length 110
Comment CutA1 divalent ion tolerance protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MLRVVMTTVESLKQAEELSDKILKQKLASCVSIFPITSKYWWKGEIERAEEILLLIKTHQ
ELVQELLNFLKVEHPYEVPEILVIPVEIANEDYLRWVEDVTVREAASSDR
Download sequence
Identical sequences B1L6A1
374847.Kcr_1234 gi|170290847|ref|YP_001737663.1| WP_012309877.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]