SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290993|ref|YP_001737809.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170290993|ref|YP_001737809.1|
Domain Number - Region: 96-156
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.0366
Family Band 7/SPFH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290993|ref|YP_001737809.1|
Sequence length 210
Comment 30S ribosomal protein S3Ae [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSSRKAHGKVKTKTWYNTYAFDIFPGQWIGETPASDPESLIGRNVEVVVRDITGDFMHEK
YKLWFKIFKVEGNKAYARFVKEMLNKDYMRSIIQRRSSRVDIQSEGVTKDGNYVRIFTLI
ITVTRIRSSQKHAIREKVDEYVRSIIPNYTVEEIIRSFIFGNPLPVTSEIQRISSKIAPI
KYVELRKMVILKPSEREAEERIESSAASGG
Download sequence
Identical sequences B1L6P7
374847.Kcr_1380 gi|170290993|ref|YP_001737809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]