SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170291081|ref|YP_001737897.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291081|ref|YP_001737897.1|
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 2.88e-41
Family Triosephosphate isomerase (TIM) 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170291081|ref|YP_001737897.1|
Sequence length 228
Comment Triose-phosphate isomerase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MHIPRLLINFKAYMESSGDRAVEISKSAERIWREMGVLIGVSPNIVDLRLISSSVEIPVF
AQHVDPIPAGAYTGHVPPILVKEAGARGSLLNHSEKQIPLRHIAESINMMRDLNLISIVC
SPTPSESAAVAALLPDAIAVEPPELIGSGIPVSKAKPEVILNSLRSVKAINSAIPLLCGA
GISSGDDVKAALELGSYGVLVASAVTKSPDPQRKIRELAEPIASFTRA
Download sequence
Identical sequences B1L6Y5
374847.Kcr_1468 gi|170291081|ref|YP_001737897.1| WP_012310111.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]