SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170291115|ref|YP_001737931.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291115|ref|YP_001737931.1|
Domain Number 1 Region: 1-268
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.57e-81
Family Purine and uridine phosphorylases 0.000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170291115|ref|YP_001737931.1|
Sequence length 270
Comment purine phosphorylase family 2 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MVRVGIIGGSGLYELLENPRIVRLDTPFGHCDVQLGELAGEEVAFIPRHGASHRLPPYKV
NYKANLYALNMLEVERIIATNAVGSINPALEPGTIVIPHDFIDMTKCRDVTFYDGETTIK
VRGREVSGVVHVSMTPYTYCPEIRASIIEAAEHMGLGVRDGGVYVCTEGNRFETPAEIRA
FSILGGDIVGMTGCPEASLARELAICYASISVVTNYAAGVSGAVKLTQGEVIEIFSRKIQ
DISRLIEETIRRIPKRRECPCKDALSEYLK
Download sequence
Identical sequences B1L719
WP_012310145.1.97847 374847.Kcr_1502 gi|170291115|ref|YP_001737931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]