SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170291129|ref|YP_001737945.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291129|ref|YP_001737945.1|
Domain Number 1 Region: 246-597
Classification Level Classification E-value
Superfamily SIS domain 1.21e-88
Family double-SIS domain 0.00000074
Further Details:      
 
Domain Number 2 Region: 2-229
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.21e-61
Family Class II glutamine amidotransferases 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170291129|ref|YP_001737945.1|
Sequence length 597
Comment glucosamine 6-phosphate synthetase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MCGIVGIVRSRVGVLSDLLKSLKSLEYRGYDSAGIAISLGDDIFILKGVGTIDQVIRGAE
IPDGSIGIGHTRWATHGGVSLENAHPQVSCDGKIAVVHNGTLDGFEQLREDLRARGHSFR
SETDTEVIAHLVEEGMREGLSPLLSLHRAVRMLEGSYAIAMISAGHNSIYLARRKSPLVI
GLGKGENYCASDVSALLHLTKEFIFLEDGELAEITPGDVRIWRGDGELVAIERRAEVVDW
SPQQMEKGRYEHFMLKEINEQPYIMMKIADTIEYYKKFSERLESALKSGSLSIVAAGTSM
HAGLIGKFYLSTLAGFGSDVIIASEFPEWSRHIANGDVILAISQSGETADVLEAVRIARD
RGAKVFSIVNVPGSTLTRLSDEYVFIQAGPEVGVAATKTFTAQVASLYVISSLISDPTSS
EDLREKLLSISNSILKDMGRVDEESRKIAGLLKSREHVFFLGRGVNYPTALEGALKLKEI
SYIHAEGYAAGEYKHGPLALIEEGVPVIALIPKERSLINKIIYNLMEVKARGSFTVTIQP
PDVSLPSDRRLVVDVEDELTSPLIYAIPLQLIAYYTALELGRNPDKPRNLAKSVTVE
Download sequence
Identical sequences B1L733
374847.Kcr_1516 WP_012310159.1.97847 gi|170291129|ref|YP_001737945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]