SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170291220|ref|YP_001738036.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291220|ref|YP_001738036.1|
Domain Number 1 Region: 8-200
Classification Level Classification E-value
Superfamily SIS domain 6.55e-39
Family mono-SIS domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170291220|ref|YP_001738036.1|
Sequence length 201
Comment sugar isomerase (SIS) [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MMGTPVVEKIGKLIEVVKENLSTVDDESANMFIKALFRTMGEGKIFVVGAGRSGLVAKAF
AMRLLHVGFQVYVVGETVTPSMRSGDLLIAVSGSGETKFPVTAAQVAKSVGAHVIAITSY
PDSTLGKIADFVVRIGGRVLPEDESRDYFTRQILGIHEPLTPLGTLFELSAMIYLDALIS
EIVELMGKSEEDLARRHANIE
Download sequence
Identical sequences B1L7C4
374847.Kcr_1608 gi|170291220|ref|YP_001738036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]