SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170748621|ref|YP_001754881.1| from Methylobacterium radiotolerans JCM 2831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170748621|ref|YP_001754881.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.77e-36
Family Ribosomal protein L6 0.0000352
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.2e-21
Family Ribosomal protein L6 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170748621|ref|YP_001754881.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Methylobacterium radiotolerans JCM 2831]
Sequence
MSRVGKKPVPVPAGVTATVTGQTVKMKGSKGELSFVVPALVNVAMKDGAIEVQPVNQSKP
ARSLWGTSRAQIANIAEGVSKGFEKKLEITGVGYRAAMAGKALKLSLGYSHDIEYAIPAG
ITIATPKPTEITISGINRQQVGQVAAEIREYRGPEPYKGKGVKYAGEFIFRKEGKKK
Download sequence
Identical sequences A0A0E9KHM6 A0A0M8ZAL4 A0A154NH14 B1LWR1
426355.Mrad2831_2203 gi|170748621|ref|YP_001754881.1| WP_012319175.1.25698 WP_012319175.1.31760 WP_012319175.1.35747 WP_012319175.1.5195 WP_012319175.1.89921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]