SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434384837|ref|YP_007095448.1| from Chamaesiphon minutus PCC 6605

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434384837|ref|YP_007095448.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily RbcX-like 3.27e-35
Family RbcX-like 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434384837|ref|YP_007095448.1|
Sequence length 126
Comment RbcX protein [Chamaesiphon minutus PCC 6605]
Sequence
MDRKQVAKATTKVISSYLTYQAVQSVLAELTEMNPPLALWLRGFSGQQILQDGEVYLHAL
LAQNQELAFRIMTVREHLVEDIMEDLPEMVFHDIKLKNSQYRKQQLEKLSQLSITEPSSP
IESSSE
Download sequence
Identical sequences K9UBW6
gi|434384837|ref|YP_007095448.1| WP_015158115.1.73630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]