SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170751116|ref|YP_001757376.1| from Methylobacterium radiotolerans JCM 2831

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170751116|ref|YP_001757376.1|
Domain Number 1 Region: 8-295
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.94e-82
Family UbiD middle domain-like 0.0000398
Further Details:      
 
Domain Number 2 Region: 298-431
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.02e-37
Family UbiD C-terminal domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170751116|ref|YP_001757376.1|
Sequence length 461
Comment UbiD family decarboxylase [Methylobacterium radiotolerans JCM 2831]
Sequence
MNAPTPVRSLRDWLDRLSGDGRLAIARPGIGLRHEAAAVASRLDGRQASLFPQPGGHPGT
IVSGLVSSRAWMAEALGTTQDHLVAHFQQAAAQPLPWHEHNSAPAQEVVHREGLDILKIL
PVPTLNEHDSGPYISAGLMISRDPETGLQNVAILRCQISGPDRIGVLVLPRHTDNFYRKA
EAQGRGLEVALVVGVDPACLLASQAIVPLGHDELEIAGALTGQPLDVVKCLTNGVRVPAN
AEIVIEGRLLPEIREPEGPFGEFPQYYGERAKRHVMQVDAVTHRRDPIFHMIVGGGLEHL
LLGAIPREATILATLQRSFPGVEDVHLSLGGVGRYHLYVRLRKTQEGEAKNVLLGAFAAH
YDIKHAVVVDTDVDIHVPQEVEWAVSTRFQADRDLVVIPHAQGSKLDPSGREGVGAKMGL
DATVPLDAPPMKFKRIRVPGEAEVDLDAVLASGADWRAAIG
Download sequence
Identical sequences A0A0E9K4H7 A0A227K8Y5 B1M734
gi|170751116|ref|YP_001757376.1| 426355.Mrad2831_4732 WP_012321646.1.31760 WP_012321646.1.5195 WP_012321646.1.89921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]