SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479326547|ref|YP_007866603.1| from Sulfolobus islandicus LAL14/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479326547|ref|YP_007866603.1|
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.97e-33
Family BT2961-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479326547|ref|YP_007866603.1|
Sequence length 172
Comment Lysophospholipase L1-related esterase [Sulfolobus islandicus LAL14/1]
Sequence
MLAKHPETKITVINSGISGNTVIDLIDRWDDDVLSYKPNWISILIGINDLHKFLGGLTTF
NPENYYENLRRLLKYTRKVLNNVNFILMTPFYISRNKLEGGFRAKVLELLPQYTEKVRLL
SNEFSATYIDLHDTFKKLVNIREPNVYAPEPVHPNFTGHMVIALKLLEVLEI
Download sequence
Identical sequences M9UBS6
gi|479326547|ref|YP_007866603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]