SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479326601|ref|YP_007866658.1| from Sulfolobus islandicus LAL14/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479326601|ref|YP_007866658.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-37
Family GHMP Kinase, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 177-311
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.36e-19
Family Phosphomevalonate kinase (PMK) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479326601|ref|YP_007866658.1|
Sequence length 322
Comment Phosphomevalonate kinase [Sulfolobus islandicus LAL14/1]
Sequence
MIRVSSPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNE
LINSVLDTFRERFTQLPQGYEIELYNDKEFILDGKKTGLGSSSAATVSLTACLYYAINGN
LDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIVYKRFTDLEKMDFYYEKLKLGNYDM
VLGFTGKSSETVGLVKKFVEKSNLEDFREIMRLIDEENNMAIKLVKLNKIDEAVEHVRLG
RKYLNYIAERIVGVKLVSKEEEELIKIAEEEGALIALSPGAGGGDSIFALGNDLSKVREA
WKRRGITTIDVKENEGLKLDSN
Download sequence
Identical sequences M9UG85
WP_015581543.1.91160 gi|479326601|ref|YP_007866658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]