SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165975780|ref|YP_001651373.1| from Actinobacillus pleuropneumoniae serovar 3 str. JL03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165975780|ref|YP_001651373.1|
Domain Number 1 Region: 83-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.53e-58
Family GntR ligand-binding domain-like 0.0000751
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.52e-16
Family GntR-like transcriptional regulators 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165975780|ref|YP_001651373.1|
Sequence length 242
Comment fatty acid metabolism regulator [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
Sequence
MDNSYILKAQSPAALAEEYIVRSIWNNKFPAGTDLPAERELADKIGVTRTTLREVLQRLA
RDGWLHIQHGKPTRVNDVWETAGPNIISTIIKLDRSYLPVIIANVVSLRTRMAESYIPEA
VRLNAEACVAFFNQLDELEDTADAFATFDYKLFRQFTFTANKPVYALILNSFKGMYHQVA
SIFFADPVCRQLTLKFYRDLLNACVEKDHEKASLIMAQNCQSSSEIWGKLLQSIPENFGE
LK
Download sequence
Identical sequences B0BT72
434271.APJL_0338 WP_012262778.1.74087 gi|165975780|ref|YP_001651373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]