SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169825910|ref|YP_001696068.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169825910|ref|YP_001696068.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 2.09e-39
Family Hypothetical protein YfhH 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169825910|ref|YP_001696068.1|
Sequence length 109
Comment hypothetical protein Bsph_0309 [Lysinibacillus sphaericus C3-41]
Sequence
MNEKNYAAMSEHELREEIAFLKEKARKAEQLGIINEFAVYERKALMAAAYLVDLNTIVPG
EMYRIDRSDNEFFQVDYLKGRFAWGHRLGGDKYQEALPVSMLSPVKVGK
Download sequence
Identical sequences A0A2G8GB99 B1HUQ8 W7RFX7
gi|169825910|ref|YP_001696068.1| 444177.Bsph_0309 WP_012292101.1.18114 WP_012292101.1.47961 WP_012292101.1.54975 WP_012292101.1.60952 WP_012292101.1.62054 WP_012292101.1.73705 WP_012292101.1.92801 WP_012292101.1.93816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]