SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169826732|ref|YP_001696890.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169826732|ref|YP_001696890.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily FlgN-like 8.5e-18
Family FlgN-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169826732|ref|YP_001696890.1|
Sequence length 166
Comment hypothetical protein Bsph_1150 [Lysinibacillus sphaericus C3-41]
Sequence
MSVEAINSTLTMLERMHKSLLELACKKTEIIKAGDIEALDQLLKDEQAHVAAIDKLEQQR
QKQVTDYLEAKGLASTDKTTVADVIEAAEKQTDKATLSVVRDRLLQIINDLRKQNDLNQK
LVFQSLQIVNLTLDAVRPRTEQMNYSSNEVLGTNNIAKKSYFDSQA
Download sequence
Identical sequences A0A2G8GK25 B1HN43 W7S3K6
WP_012292897.1.18114 WP_012292897.1.47961 WP_012292897.1.54975 WP_012292897.1.60952 WP_012292897.1.93816 gi|169826732|ref|YP_001696890.1| 444177.Bsph_1150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]