SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169827007|ref|YP_001697165.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169827007|ref|YP_001697165.1|
Domain Number 1 Region: 171-565
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.54e-98
Family beta-Lactamase/D-ala carboxypeptidase 0.0000477
Further Details:      
 
Domain Number 2 Region: 51-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.36e-34
Family Penicillin binding protein dimerisation domain 0.0015
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169827007|ref|YP_001697165.1|
Sequence length 638
Comment stage V sporulation protein D [Lysinibacillus sphaericus C3-41]
Sequence
MKWISIHSKKRLRILYVLFMCAAVAIVIRLFFLQVLDQKELTSKAEENWDREIPFANERG
HITDRDGESIVTNKLAPTLYFMPSQSKDIEGAAEKIAQVLEVDKEKLLEKMKKKAYLVKL
APEGKNIPYEKAVELQGLQIEGLYSGVDYSRDYPYGTLLSRFLGFTGYDAQGLAGIEYEY
DKFLQANSSAIRLFTDAKGNNLPNVASAWKAGEDGATIELTIDVDVQQVVERELSQAMKR
YEADQALAIAMNPNNGEILALASYPTFNPAEYQLVEPTIYNRNLPVWMTYEPGSTFKIIT
LSAALEENLVDLEHDTFYDPGYTMVAGARLRCWKREGHGHETFLEVVENSCNPGFVELGQ
RLGNERLLQYIKDFGFGQKTGSNIAGEASGILFSKEAFGPVEQATTSFGQGVAVTPIQQV
QAVAAAINGGKLYTPYVVKKVFNPNTGDVIQETEPVVKNQVIREETSAKVRGALESVVAN
GSGRQAFRDGLRIGGKTGTAQKVENGRYKSGEYIVSFIGFAPADNPQIVVYVAVDNPKKT
TQFGGVVAAPIVGQIIEDVAPFVGIEKSKEQLEKDYRYGDPITVKVPNFIGQTKDDIAKQ
FYPFRIEWHGEGTKIGNQLPEVDSVIKQDGTIHLYLEN
Download sequence
Identical sequences A0A2G8GKT4 B1HPY3 W7RST2
444177.Bsph_1429 gi|169827007|ref|YP_001697165.1| WP_012293155.1.18114 WP_012293155.1.47961 WP_012293155.1.54975 WP_012293155.1.60952 WP_012293155.1.92801 WP_012293155.1.93816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]