SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169827225|ref|YP_001697383.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169827225|ref|YP_001697383.1|
Domain Number 1 Region: 255-554
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.05e-83
Family DNA repair protein MutS, domain III 0.000000947
Further Details:      
 
Domain Number 2 Region: 557-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.72e-63
Family ABC transporter ATPase domain-like 0.000000596
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.32e-43
Family DNA repair protein MutS, domain I 0.0000237
Further Details:      
 
Domain Number 4 Region: 114-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.01e-22
Family DNA repair protein MutS, domain II 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169827225|ref|YP_001697383.1|
Sequence length 856
Comment DNA mismatch repair protein [Lysinibacillus sphaericus C3-41]
Sequence
MTTYTPMMQQYLQVKEDYKDAFLFFRLGDFYEMFFEDAINASQILEITLTSRDAGAKERI
PMCGVPHHSAKNYIETLVQKGYKVAICEQTEDPKQAKGVVKREVVQLITPGTIMEGKTLE
GKSNHFIGAAEQLDDTTFGYAYLDLSTGEAVASSIEGDGKALLMQMQAYGIRELIVTDSL
QLLLAEHAANAAIVLSVEADEMTMDKAASYVEAVPPALQISCLRLLAYIDKTQMRSLSHI
QAFTFNEMKHYLRIDSSSKRNLELIQSIRGGDQKGTLLWLLDDTVTAMGGRKLKQWLHQP
LATRSAIESRLAIVTDLLEEYFVRTELQTALKQVYDLERLAGRVAFGNVGGRDLAQLRDS
LRQVPAIQQQLMGAGKETLQQIGVALDTCTDVVELLAKAITDNPPITIKEGDVIRDGYHG
RLDELRYAARNGKDWIAQLEQEERLKTGIKNLKIGYNRIFGYYIEITKSNIHLADLTRYE
RKQTLANAERYITQELKEKEALILNAEEESLALEYNLFVEIRDALKEFIPRVQALAASIS
ELDVLLSFASISEKYRFTKPQFHNGRALEIIEGRHPVVEKMLNKQMYVPNDCVLEEQNNM
MLITGPNMSGKSTYMRQVALIVVMAQMGCYVPAEKAKLPITDQIFTRIGAADDLAAGQST
FMVEMLESQHAIMHATKNSLMLFDEIGRGTSTYDGMSLAQSMMEYIHDKIGANTLFSTHY
HELTALEKDLPRLQNVHVAATEKNGMVVFLHKVKKGAADKSYGIHVAQLAQLPEEILARA
RVLLENFEAGNEVVAEAQKIAEPPLQMSLFTEEEPMAPAEAEVLKKLEKVNILGTSPMQA
MNILYELQQELLNMKK
Download sequence
Identical sequences B1HRG8 W7S935
WP_012293356.1.18114 WP_012293356.1.47961 WP_012293356.1.54975 WP_012293356.1.60952 WP_012293356.1.93816 444177.Bsph_1655 gi|169827225|ref|YP_001697383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]