SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169827790|ref|YP_001697948.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169827790|ref|YP_001697948.1|
Domain Number 1 Region: 289-509
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-39
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 21-285
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.88e-24
Family DNA repair protein MutS, domain III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169827790|ref|YP_001697948.1|
Sequence length 634
Comment DNA mismatch repair protein [Lysinibacillus sphaericus C3-41]
Sequence
MNFTTLEKLQYQELKDIVKSYCVSGLGKQLLDKLMPSSNLAIVKTRLNETTEARVIVDAE
GHVPFLGVSNIEHIMTKLAKGMILDPSELISMSDFLRGCRNIKKFMLDKEFFAPVLSSYA
NSMAEFKNVEEEINFAIKANRVDSAASRELKRIRHHIETTEEKIKERLTKFLNNSANKTY
IQEFFISQKDDRYTIPIKASYKNHVQGTIVEISSKGATVFMEPSIVAKLNGELATLKAEE
AVEEYQILASLSGLLMNHLHALHINMELISQYDMVFAKAKFSKQIGGMEPRLNDYGYIQV
INGRHPLLPGNAVPLQFTIGKDYRSLIITGPNAGGKTVVLKTIGLLTLATMSGFHIVADE
GTELAIFDHIFVDIGDNQSMENALSTFSSHMKNLSDIMRASNNHTLLILDEIGSGTEPNE
GAALAIAILEEFYQMGCITIATTHYGEIKRFSEMHPDFMNAAMRFNSETLEPLYQLMIGT
SGESNALWISKKMNVRAEVLQRAQDYMNHKDYQLTRVQDSKIRKPKVEKAGRAAIIEFAK
GDRVKLLDHDDVGLVYQEMNQFYNVTVYYKGEMLEVHVKRLALELPATELYPEGYDLETL
FVDYQERKLQHDIERGSKKALRKIHKQIKEDHQQ
Download sequence
Identical sequences B1HVX0 W7RQN0
WP_012293906.1.18114 WP_012293906.1.47961 WP_012293906.1.54975 WP_012293906.1.60952 WP_012293906.1.93816 gi|169827790|ref|YP_001697948.1| 444177.Bsph_2253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]