SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169829345|ref|YP_001699503.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169829345|ref|YP_001699503.1|
Domain Number 1 Region: 116-296,425-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.13e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000631
Further Details:      
 
Domain Number 2 Region: 293-420
Classification Level Classification E-value
Superfamily GAD domain-like 2.29e-42
Family GAD domain 0.00017
Further Details:      
 
Domain Number 3 Region: 4-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.07e-30
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169829345|ref|YP_001699503.1|
Sequence length 589
Comment aspartyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
Sequence
MATRTHASNELSETLQGEKVVLKGWVQRRRDLGGLIFIDLRDRTGITQVVFSPDVAEAHA
LADKVRSEYVIEIEGTVILRTEDQINPNVPNGKIEVEATRLVVINTAKTTPFQIEDRTDV
SEDLRLKYRYLDLRRPVMFDTFKMRSDVTRTIRNFLQNEGFLEVETPILTKSTPEGARDY
LVPSRVHEGEFYALPQSPQLFKQLLMVAGFEKYFQIARCFRDEDLRADRQPEFTQVDIET
SFLTQEEVLEMNERLIQAVMKEVKGIDIPAPFQRMKYQEAMDRYGSDKPDVRFGLELVAL
NDVFEGCGFKVFADTVAQGKQVKSINIKGAADKYSRKDMDELTKFVGIYGAKGLAWLKVT
EEGLNGPIAKFFDEALAAALIERMGAEVGDILVFVADKASVVAASLGALRTKLGQDLDLI
DESQFAFLWITDWPLFEYSEEDGRYYAAHHPFTRPFDEDIPLMDTDPSAVRAQAYDIVLN
GYELGGGSLRIYERDLQEKMFELLGFSEEEAQAQFGFLLEAFEYGVPPHAGLAFGLDRFV
MLLAGRHNLRDTIAFPKTASASCLMTEAPSEVSPEQLSELSLAIKPFRK
Download sequence
Identical sequences A0A2G8GES9 B1HV71 W7S4U0
444177.Bsph_3901 WP_012295418.1.18114 WP_012295418.1.47961 WP_012295418.1.54975 WP_012295418.1.60952 WP_012295418.1.62054 WP_012295418.1.73705 WP_012295418.1.92801 WP_012295418.1.93816 gi|169829345|ref|YP_001699503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]