SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169829506|ref|YP_001699664.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169829506|ref|YP_001699664.1|
Domain Number 1 Region: 294-516
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.31e-44
Family ABC transporter ATPase domain-like 0.000084
Further Details:      
 
Domain Number 2 Region: 22-289
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 7.59e-22
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 711-787
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000011
Family Smr domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169829506|ref|YP_001699664.1|
Sequence length 788
Comment MutS2 protein [Lysinibacillus sphaericus C3-41]
Sequence
MIAERALKTLEYDKVRQQVATYCTSSIGKSAIEELVPQTDYDKVVQLLEEMDEGLSILRV
KGNVPMGGIFDVRPSARRAQIGGMLAAIELMEISSTIRASRILRNFIEDLEADEVIEIPH
FIAKKETMPVLTGLQHEINNCIDDNGAVLDSASTTLRTIRQSLRSEEAKVRSKLESLIRG
SNASKMLSDTLVTIRNDRFVIPVKQEYRHHYGGIVHDQSSSGQTLFIEPDSIVQANNEIH
RLKMKEQAEVERILLALSAMVQDVAPDLFNLVKVLGDIDVILAKGKYGQANKCTMPKMNQ
DGYIRLVRARHPLLPIDIAVPNDIEFGKDITAIVITGPNTGGKTVTLKTVGLCTLMAQAG
LPVPALDGSQLAVFKQLFADIGDEQSIEQSLSTFSSHMVNIVDILQKFDHESLVLFDELG
AGTDPQEGAALAISILDEVHGRGARVMATTHYPELKAYGYNRPGVANASVEFDIETLSPT
YRLLIGVPGRSNAFEISSRLGLPESIIERAKGFTGTDRHEVESMIASLEETRRQSEDDAE
RSHALLLESESLRKELQDKLQAYEERKEALDKKAKEKARKIVEEAKREAEGIIAELREMR
KNADQVVKEHELIEARKRLEEATPLENNKVLKKAAQVKARAQNLVVGDEVKVLSYGQRGT
LLEKVSNTEWVVQMGILKMKISDSDLEYIKPEKEPIVRTAGVKNRNGHVKLELDLRGERY
EDAILRTEKYIDDALLANYGRVSIIHGVGTGALRQGIQSYLKNNKRVKSFRFGEAGEGGL
GVTVVELK
Download sequence
Identical sequences B1HW95 W7S144
gi|169829506|ref|YP_001699664.1| 444177.Bsph_4066 WP_012295572.1.18114 WP_012295572.1.47961 WP_012295572.1.54975 WP_012295572.1.60952 WP_012295572.1.62054 WP_012295572.1.92801 WP_012295572.1.93816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]