SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169829675|ref|YP_001699833.1| from Lysinibacillus sphaericus C3-41

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169829675|ref|YP_001699833.1|
Domain Number 1 Region: 448-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.73e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169829675|ref|YP_001699833.1|
Sequence length 592
Comment sulfate transporter ychM [Lysinibacillus sphaericus C3-41]
Sequence
MLCLLLGREDLSMKSLFTGRFEGYSVHHAKKDLLSGIIVGIVAIPLAMSFAIASGVKPEY
GIYTACIAGILISIFGGSKYQIGGPTGAFVPILLGIVLTYGYEDLLLAGLMAGVLLCLMG
IFKLGTLIKFIPRPVTIGFTAGIAVIIFTGQIANFLGLSNMTRHEYFIANIQEIGKQIGT
TNIYSILTAVICLITIIMTPKFFPKVPGALVGIVVSTLVATFFFSGQVATIATAYGQIPN
TLPNFALPTMTFERLQQLIGPAFVIAMLGGIESLLSAVVADGMTNSKHNSNRELIGQGIA
NIVTPMFGGIPATGAIARTATNIKTGAVSPMSGIIHGVFVLLTLLLLAPYASHIPLASMA
PVLMVVAWNMSERKHFSHIIKLKSGDSLVLLITFLLTVFTSLTLAVEVGLVLAVLLFAKR
MSEKLVVTKVLPDHSNKSEKVQPHVVHQQHDCPQISMYTIEGPLFFGAAQRFEQMIEGTL
QQRPRVLILRMGKVPFMDSTGEAYFSNIIDNFTAQGGNILVTGVQDDLKVALQQNGLYAK
IGAHHFYQHTGEAISRALNYLDRTQCIGCQHFAFHECKDLSKSEEKKDLIVQ
Download sequence
Identical sequences B1HXY8 W7S5Z8
444177.Bsph_4242 gi|169829675|ref|YP_001699833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]