SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170078359|ref|YP_001734997.1| from Synechococcus sp. PCC 7002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170078359|ref|YP_001734997.1|
Domain Number 1 Region: 67-150
Classification Level Classification E-value
Superfamily LCCL domain 1.24e-20
Family LCCL domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170078359|ref|YP_001734997.1|
Sequence length 151
Comment LCCL domain-containing protein [Synechococcus sp. PCC 7002]
Sequence
MKYLTLGSCVFLGLAIAPVATLAHHDPAPTVAHHQPTTQISHHQPSTQTAKVRAIDWETT
PGMLGLRSQIGQTLNVICPAGQPTEKIWGTDIYSDGSSICTAAVHAGLVEPTTGGNVTVK
VLGSQTDFVGTERNGITTSSYGPWGGSFEVE
Download sequence
Identical sequences B1XPM7
gi|170078359|ref|YP_001734997.1| 32049.SYNPCC7002_A1752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]