SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170078403|ref|YP_001735041.1| from Synechococcus sp. PCC 7002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170078403|ref|YP_001735041.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily RbcX-like 1.54e-54
Family RbcX-like 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170078403|ref|YP_001735041.1|
Sequence length 134
Comment RbcX protein, rubisco chaperone [Synechococcus sp. PCC 7002]
Sequence
MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAM
MLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQVDSSSTDQT
EPNPGESDTSEDSE
Download sequence
Identical sequences Q44177
WP_012307408.1.22074 WP_012307408.1.52632 WP_012307408.1.62705 2peqA gi|170078403|ref|YP_001735041.1| 2pem_A 2pem_B 2pem_C 2pem_D 2pem_E 2pem_F 2pen_A 2pen_B 2pen_C 2pen_D 2pen_E 2pen_F 2peq_A 2peq_B 2z44_A 2z45_A 2z45_B 2z46_A 2z46_B 2z46_C 2z46_D 2z46_E 2z46_F 32049.SYNPCC7002_A1797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]