SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333314|ref|YP_001514486.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333314|ref|YP_001514486.1|
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-29
Family Phosphoglucomutase, first 3 domains 0.00095
Further Details:      
 
Domain Number 2 Region: 186-281
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-25
Family Phosphoglucomutase, first 3 domains 0.00047
Further Details:      
 
Domain Number 3 Region: 286-393
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000000353
Family Phosphoglucomutase, first 3 domains 0.002
Further Details:      
 
Weak hits

Sequence:  gi|158333314|ref|YP_001514486.1|
Domain Number - Region: 448-499
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0942
Family Phosphoglucomutase, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333314|ref|YP_001514486.1|
Sequence length 512
Comment phosphoglucomutase/phosphomannomutase family protein [Acaryochloris marina MBIC11017]
Sequence
MTLTAFNWPQLQNGSDIRGVALEGVEGEAVNLTPEIAQILGMAFVHWLSQTLNKSTSELT
VGVGRDSRISGPTLMDAVLAGITKMGSNGYNFGLASTPAMFKSTVTDGFNCDGAIMLTAS
HLPFNRNGLKFFTAQGGLGKGDITQILSLAAEQTFEKAADPGQVSEHNFIGVYAAELVSQ
IRAAVNHPDQFEQPLQGLHIVVDAGNGAGGFYAEQVLKPLGADITGSQFLDPDGTFPNHI
PNPENKEAMAAICQAVTEQQADFGIIFDTDVDRAAAVDHLGQDLNRNRLIALISAVVLRE
HPGSTIVTDSITSDGLSQFIGDELGGVHHRFKRGYKNVINESVRLNQSGQESWLAIETSG
HGAMKENYFLDDGAYLISKLLVELAKSKMAGRNITDLIANLTEPQESEEYRIKIQTDDFK
AHGNSVISKLEEFAGQQTDWQIVPNNYEGIRIALNSPSEQGWLLLRLSLHDPVLPLNIES
NVEGGVASISAKLTSFFQSIDGLNLPPELISS
Download sequence
Identical sequences B0C560
329726.AM1_0084 WP_012160792.1.67183 gi|158333314|ref|YP_001514486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]