SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333400|ref|YP_001514572.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333400|ref|YP_001514572.1|
Domain Number 1 Region: 557-853
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.51e-103
Family WD40-repeat 0.00000465
Further Details:      
 
Domain Number 2 Region: 889-1153
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.01e-96
Family WD40-repeat 0.00000705
Further Details:      
 
Domain Number 3 Region: 99-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-37
Family Extended AAA-ATPase domain 0.088
Further Details:      
 
Domain Number 4 Region: 26-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000153
Family SinR domain-like 0.073
Further Details:      
 
Domain Number 5 Region: 509-560
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000419
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333400|ref|YP_001514572.1|
Sequence length 1191
Comment WD repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MSRSLSVRSDCIARTKVVLKRSGFHSQRSLAEYVGFSLSTVSNFLRGKPVDFATFVELCE
QLNLDWQTVADLGDPVQKSSSQLQSPPSQSPTPPANFQDWGEAIDVSRFYGRSADLVTLH
TWIQTDQCRLITILGMGGVGKTSLAVKLAQELQDQYDTVIFRSLRNAPAVESLLSQLIQV
LSHHQETRVFESIADLLSRLVQHLQERRCLLILDNVESILEDCNRAGVYRAGYEGYGQLF
KIVGETYHQSCLLLTSREKPQGLNGLEGDKLPVRCHQIQGLSTQAGREIFSAIGTYRGGE
EDWSTLIERYTGNPLALKIVATFIRDVFDSNLSHFLSFLQQEPFIFDDIQDLLSQQFQRL
SAHEAEVLYWLAIHREPVSYQDIQADILSPTALGELLQTVAALQNRSLIEKSDHFFTLQP
VVMEYMTVQLIQEVSTSIQQHQINWLAQYPLVKAQAPVSVVETQRCLIVQPIVDRLLATF
GTPEAIIEHIFALIPQLQEQVHLEKGYFCSNLLHLAKVMKVDMSGRDFSEMTIRQADLQG
MVLHSTNFANVKFFDSTFSEILDEVKAVAFSPDGRYLAIADQDCKVRVWCAHTYQQLWVG
HEHQNAVLSVSFSPDNQTLASASADHTLKLWNAEAGNCLYTFHGHDSEVCAVAFSPDGQL
LASGSRDTTLKIWEVNDYTCLQTLAGHQQAIFTVAFSPDNSRIASGSSDKTIKLWDVDEG
TCQHTLHGHNNWIMSVAFCPQTQRLASCSTDSTIKLWDGDSGELLQTLRGHRNWVNSLAF
SPDGSSLVSGSGDQTIKLWDVNQGHCLHTLTGHHHGIFAIAFHPNEHLVVSGSLDQTVRL
WDVDTGNCLKVLTGYTNRIFAVACSPDGQTIASGSFDQSIRLWDRKEGSLLRSLKGHHQP
IYSLAFSPNGEILASGGGDYAIKLWHYHSGQCISALTGHRGWIYGLAYSPDGNWLVSGAS
DHVIKVWSLNSEACTMTLMGHQTWIWSVAVSPNSQYIASGSGDRTIRLWDLQTGENIHTL
KGHKDRVFSVAFSPDGQLVVSGSFDHTIKIWDVQTGQCLQTLTGHTNGIYTVAFSPEGKT
LASGSLDQTIKLWELETGDCIGMFEGHENEVRSLAFLPPLSHADPPQIASGSQDQTLRIW
QMNSRACQKILKVKPLYDGMNIAGAMGLTKAQKASLKALGACEHFMADTLE
Download sequence
Identical sequences B0C7J8
gi|158333400|ref|YP_001514572.1| 329726.AM1_0172 WP_012160871.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]