SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333484|ref|YP_001514656.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333484|ref|YP_001514656.1|
Domain Number 1 Region: 110-287
Classification Level Classification E-value
Superfamily E set domains 7.46e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000964
Further Details:      
 
Domain Number 2 Region: 24-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-18
Family Voltage-gated potassium channels 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333484|ref|YP_001514656.1|
Sequence length 288
Comment K+ channel, inward rectifier protein [Acaryochloris marina MBIC11017]
Sequence
MPQKSYLKFQDGKFSISGLGVWYTYWRDPYHLLLTIPWLGFLLILVGGYLVINVLFALAY
LAGGDCIANATPGSFWDAFFFSVQTLGAIGYGAMHPTTAYANFVVTIEAFTSILSVALIT
GLAFARFSRPTTRVLFSHVAVITPYNGVPTLMFRTANQRRNQILEAEINLYFLQDEISTE
GDAMRHLYNLNLLRPRTPSFTLTWTVMHPIDESSPLYGATAESLERTKATLIVTLTGIDD
TVAQSLHARHTYGALDIIWDHKFIDIFHQTPDGHRYIDYTHFHDVAPK
Download sequence
Identical sequences B0C8V2
gi|158333484|ref|YP_001514656.1| WP_012160952.1.67183 329726.AM1_0256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]