SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333613|ref|YP_001514785.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333613|ref|YP_001514785.1|
Domain Number 1 Region: 17-242
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 2.09e-88
Family Undecaprenyl diphosphate synthase 0.000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158333613|ref|YP_001514785.1|
Sequence length 250
Comment undecaprenyl pyrophosphate synthase [Acaryochloris marina MBIC11017]
Sequence
MTLNSSLPKQLPSDLDVQRLPKHVAVIMDGNGRWAKQRGLPRIVGHRRGVDTLKSLLRCC
KDWGVQALTAYAFSTENWGRPLDEVEFLMMLFERVLRRELQEMIDEGVQIHFVGDLEALP
LTLQTEIQRAMTATKDNHTIKFIVATNYGGRREIIQACRNIASKVQHNQINLDDIDESLF
ERHLYTAGIIDPDLLIRTSGEMRVSNFLLWQMAYAELYVTKTLWPDFDRDEFHQALKDFQ
DRHRRFGKVN
Download sequence
Identical sequences B0CAY1
gi|158333613|ref|YP_001514785.1| 329726.AM1_0414 WP_010473380.1.53659 WP_010473380.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]