SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333618|ref|YP_001514790.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333618|ref|YP_001514790.1|
Domain Number 1 Region: 223-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-94
Family RecA protein-like (ATPase-domain) 0.0000000683
Further Details:      
 
Domain Number 2 Region: 16-173
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000000000068
Family GSPII protein E N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333618|ref|YP_001514790.1|
Sequence length 668
Comment type IV pilus assembly protein PilB [Acaryochloris marina MBIC11017]
Sequence
MVNSSSQRRALVTRHNFSPFGNKLISTGYVDQDQMREATLESRRSGRSLVEILQGLTGQS
LPPELLRQYKRQQLFELKILYGIDSLDLELSQIPTDQIEELIQNYISLDLCRRYQLVPLT
LDKETDPATLLVAMVDPDNLGALDDLGRILREKNLTLQRMVIAVEDYQQLISKYLDQQAA
EQKANEKPIEFDLDDDLDAIAGLDDLPSDELETDLGAALQDAETAPIIGLVNKILAKALQ
NGVSDIHIEPQEDHLRVRFRKDGVLQQAFDPLPRKIIPAVISRFKIISDLDIAERRLPQD
GRIRRLFQGRKIDFRVNTLPSRYGEKIVLRILDNSSTQLGLDKLVSDEDSLNIVREMVSR
PFGLILVTGPTGSGKTTTLYSALAECNHPGVNISTAEDPIEYTLPGLTQVQVIREKGMDF
ASILRAFLRQDPDVILVGETRDKETAKTAIEAALTGHLVLTTLHTNDAASAVARLAEMEV
EPFMVSASLLGVVAQRLVRRVCSDCKVPYQPTPTELGRFGLSASPGTEITFYKANTLSAD
ELQTAQATGQTVCSTCNGIGYKGRCGVYEVMQITETLQTLITEGAPTERIKEVAVEEGMK
TLLAYSLELVKKGDTTLAEVERVTFTDSGLEAELKAKRKTSLTCRVCDADLRPEWLDCPY
CTTPRFQD
Download sequence
Identical sequences B0CAY6
gi|158333618|ref|YP_001514790.1| WP_012161083.1.67183 329726.AM1_0419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]