SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333640|ref|YP_001514812.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333640|ref|YP_001514812.1|
Domain Number 1 Region: 454-867
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.44e-119
Family Iron-containing alcohol dehydrogenase 0.00000149
Further Details:      
 
Domain Number 2 Region: 15-459
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-82
Family ALDH-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158333640|ref|YP_001514812.1|
Sequence length 902
Comment bifunctional acetaldehyde-CoA/alcohol dehydrogenase [Acaryochloris marina MBIC11017]
Sequence
MMTTQTQPQVTDIPSLEDLIARVKQAQEVYATYTQEQVDHIFKQVAIAANAERIPLAKQA
VAETGMGVIEDKVIKNHFASEYIYNKYKHEKTCGVVSADAHYGIQKVAEPLGIVAGIIPT
TNPTSTAIFKALLCLKTRNAIIFSPHPRAKHCTVRAVEIIRDAALQAGAPPDIVGWIDEP
TLDLSQALMQHADIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIDETADIQVAVSS
ILLSKTFDNGMICASEQSVVVTEAVYEQVKQEFRKRGAYFLTSEEKDKVAQTILKNGKLN
PAIVGQPISELATLAGIEGPQDHKVLIGEVSTIGSSEPFAYEKLSPILAMYRAADFTDAV
DQAKQLVNFGGRGHTSVLYTAASNCDRIRIFETELATARVLINTPSSQGAIGDLYNFKLD
PSLTLGCGTWGGNSISGNVNVQHLLNIKTVTERRENMLWFRVPPKIYFKYGCIPVALRDL
AEKKRAFIITDRPLFDLGLTKEITETLDQLGIEHHLFFDVEPDPDLSTVKRGLDVINTFQ
PDVIIALGGGSPMDAAKVMWLMYEHPEVEFDGLAMRFMDIRKRVYELPPLGNKAILVAVP
TTSGTGSEVTPFAVVTDDRVGIKYPLADYALTPTMAIVDPELVLNMPKKLTAYGGVDALT
HALEAYVSVLATEFTDGLALEAISLLMTYLPRAYHQGSADPEAREKVHYAATIAGLAFAN
AFLGICHSLAHKLGSTFHVPHGLANALMISHVIRYNATDAPFKQAIFPQYEYPQAKGRYA
AIADSLNLRGTTADEKVERLITAIENLKQELDIPSSIREVLSVDEQTFFEHLDLMSEQAF
DDQCTGANPRYPLIRDLKALYLEAYQNSSQATTLATEIALEAAAHNQALLGKNINFTSIE
NS
Download sequence
Identical sequences B0CB08
gi|158333640|ref|YP_001514812.1| 329726.AM1_0442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]