SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333669|ref|YP_001514841.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333669|ref|YP_001514841.1|
Domain Number 1 Region: 856-1062
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.97e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.00028
Further Details:      
 
Domain Number 2 Region: 331-534
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.03e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.0003
Further Details:      
 
Domain Number 3 Region: 55-140
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.58e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 4 Region: 148-194,309-363
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000000244
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0065
Further Details:      
 
Domain Number 5 Region: 763-848
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000589
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0059
Further Details:      
 
Domain Number 6 Region: 195-284
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000458
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0047
Further Details:      
 
Domain Number 7 Region: 602-713
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000272
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333669|ref|YP_001514841.1|
Sequence length 1074
Comment AcrB/AcrD/AcrF family protein [Acaryochloris marina MBIC11017]
Sequence
MVHSSVVAPSHKLSLVGRITAYFINSQVTVLLIAALVLFGVGAAVFTPQEENPQIVVPAA
EVILPYPGVSAEVVENMVTNPIEAKLRELTGVEHLYSVSQNSGAKITVQYFVGEDWEDSL
FKLQNHLYNHQDLLPPEASYLVKPVIIDDVPIVTLTLTGKGYTDNQLRRVGERLLNDLRS
IPDTANLTMVGGKPRAIRVDLDPDKLASYRLSPAQISQQLQVENVQLPTGDVSVGETRLF
LEGGNLFQSAADVGEIMVGFGTATDQGHPRPIYLKDVAAVVDDFGDLTTVSRIHYRPDWD
IANPYPDPSSQAQGEFITQPAMTIGIAKKKGTNAVTVAQQIFDRVDDLQSQLPPGVQIAV
TRNDGQTAARAVGDLYQSLLIAIATVVGLLVMFLGWREAAIVAFVIPLTLAGTLAVGWLA
GQTINRITLFALILALGTLVDDAIAVTENIHRHFESVLPSDRRQKTAAAISAVNELGTPI
LLSTITVILAFLPMRFVTGMMGPYMGPIPFNVPVAMLISTTLAVTVTPFLALRLIQLQPH
SKTLPSIQQTRIYRGYRWVMAPLLDSASRRRFVLLGVTGLLLATMILPLTQAVRFRMLPK
ADKDTFLVQVDAPLGTELATTNHLVEDLEAVLQQETDITHFETYVGTGSPLDFNGMLRGA
TDRQAEHFADIRVHLTNKDARSRQSEAIVFALRPQLEQMATRHNALVKLVEDPPGPPVRS
TMLAEVYGPDYGQLRALAKQVRQVFAQTDAVVDIDDSVKNQMPQMRLVVDREKAQRARLA
TQEIAQTLRVAIAGAQVSTLKVADELSPVGIQVRFADANRQSMDDLHRIQLPTANDALVS
LSELVQFQPTTVDQPIFHKDQRAVSYVMGEMGDRSSVYAVIDQLVYFWRHPLPQGYWIQW
DGEWKLTLDVFRDLGLAMLVAVLLIYLILVGQFRSFKVPLIILGSIPLALIGILIGFSLN
GVYFSATAMIGVIALAGIVVRNAIVLLEFVGDKLREGTDLKLAILEAGATRFRPILLTSV
TTMLGTLSILSDPVWSGLAWTLLSGMLASSLLTLVVIPLMYYGECRNPDSLTNP
Download sequence
Identical sequences B0CBY5
329726.AM1_0471 gi|158333669|ref|YP_001514841.1| WP_012161133.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]