SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333780|ref|YP_001514952.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333780|ref|YP_001514952.1|
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.96e-78
Family SAICAR synthase 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333780|ref|YP_001514952.1|
Sequence length 245
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Acaryochloris marina MBIC11017]
Sequence
MSTGEFLYEGKAKIIYRTDDPDILLAQYKDDATAFNAQKRGTITNKGRINCAIATHLFKV
LEAAGIATHFIDQPNPDQMRMRAVQIVPLEVVVRNIAAGSLCQQTGLALGVPLSQPLVDF
YYKDDALGDPLLTRDRIFLLELTTPEQLEQLRQLALRINQILINFFHQCGITLVDFKLEF
GMTSDQQLLLADEISPDTCRLWDDAESDPTRRVMDKDRFRRDLGEVDTAYARVMERVLAQ
DIYVP
Download sequence
Identical sequences B0CD47
WP_012161237.1.67183 329726.AM1_0588 gi|158333780|ref|YP_001514952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]