SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333781|ref|YP_001514953.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333781|ref|YP_001514953.1|
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily Ava3019-like 4.05e-41
Family Ava3019-like 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333781|ref|YP_001514953.1|
Sequence length 136
Comment hypothetical protein AM1_0589 [Acaryochloris marina MBIC11017]
Sequence
MSPSPTVQQSQAALAKFAALDPPPITTAEEREQAKTDLLALAQATDYQMFGILAETCDQA
IAALTAYSQAFGYEMPTNWQPITGPTYLKFNPNLGSCYTDNYVGNHRGVLISFQSESEEI
INQTYGHFPLDLFSNP
Download sequence
Identical sequences B0CD48
WP_012161238.1.67183 329726.AM1_0589 gi|158333781|ref|YP_001514953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]