SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333955|ref|YP_001515127.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333955|ref|YP_001515127.1|
Domain Number 1 Region: 123-331
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.66e-55
Family BC ATP-binding domain-like 0.000000845
Further Details:      
 
Domain Number 2 Region: 15-122
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-30
Family BC N-terminal domain-like 0.0000374
Further Details:      
 
Domain Number 3 Region: 335-406
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.27e-18
Family BC C-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333955|ref|YP_001515127.1|
Sequence length 408
Comment phosphoribosylglycinamide formyltransferase 2 [Acaryochloris marina MBIC11017]
Sequence
MISRPANTSLAAPWGAPFSDSAKRLLLLGSGELGREVALEAMRLGIEVIASDAYDHAPAM
QFAHRNVVINMQDGAALRQVVESVKPDLIVPEIEAIATATLLDLEAEGWNVIPTAKATNL
TMDREGIRRLAASDLGLKTSPFQFASTQAEYEQAVQKVGLPCVVKPVMSSSGKGQSLVKT
DSEIIPAWTYALEAGRGNAPRVIVEGFVEFETEITLLTVRSQSGTHFCSPIGHVQQSGDY
RESWQPCPLHPDTLQACQDMARQITDALGGWGLFGVELFIAGPADQAQTVYFSEVSPRPH
DTGMVTMVSQNMSEFELHARAILGLPIGDIQLVSPGASAVILASDASKEPKIEGVAAALT
VPTSRVRLFGKPTAHKNRRMGVALALGETIEEARQRAKTCAQQVTVTS
Download sequence
Identical sequences B0CFC6
gi|158333955|ref|YP_001515127.1| 329726.AM1_0769 WP_012161396.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]