SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158333973|ref|YP_001515145.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333973|ref|YP_001515145.1|
Domain Number 1 Region: 10-162
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.28e-35
Family Pentapeptide repeats 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333973|ref|YP_001515145.1|
Sequence length 189
Comment pentapeptide repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MTAEELMERYASGERDFTGIELQYVRLNRVVLSGANFNGANLRGIFLVDSDLAGSTLRQA
NLVDSTLTNVNFQNADLTEADLSCADLDHSILREATLVGAQIYQASLRGACLAYANLRGA
DMGQAGVDGADFTHADLRDAFLKEVAFEADLSYADFRGAETWDNIEAIFTPGILCNTLLP
DGRIRNDDC
Download sequence
Identical sequences B0CFE4
329726.AM1_0787 gi|158333973|ref|YP_001515145.1| WP_012161414.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]