SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334004|ref|YP_001515176.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334004|ref|YP_001515176.1|
Domain Number 1 Region: 120-272
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-19
Family Phage lysozyme 0.0072
Further Details:      
 
Weak hits

Sequence:  gi|158334004|ref|YP_001515176.1|
Domain Number - Region: 391-481
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.000222
Family L,D-transpeptidase catalytic domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334004|ref|YP_001515176.1|
Sequence length 501
Comment hypothetical protein AM1_0818 [Acaryochloris marina MBIC11017]
Sequence
MPFITAKKNTLLAPLPHQPHLQKLNQLAKVYEGGILGVIKVSTVNSQLAEIILAGPYTWH
DHYPTIETGVKRYINPISWDIPEDAWEQQPVSALAPASTPSQPETPSAPLLPPEVAQLNH
FYEGCQRKLPDGRIQAYPDPRAGSGGLPVTIGWGSTYYKNGSAIQMGDIITQAEADDLYD
YICHKDFWLKLQSTIPYWDDMTDLQRAALTSFAYNNGADFYGSPNHRTITRNLKDKDWQA
VPGTLMMYRNPSENVEVGLGRRRYAEAKVWCGEAPTTACAAAAQEIQTAQDCEPIEQRLK
TNPPRVVGFEPTITVSQPTPSAGPRQANIIAGMKGPKSHPDAHGFKPGDYHLVANDAVGK
IKCYDYSGTLMWELTCLCRGQFEDNYFGRHGDTPAGLYKCGQIYRDYEQAGESSAYTRDR
MSYGWYSLDLVELENQEANLGRAGIMLHGGGSGCGWPGAWAPKQALFSTLGCIRMHNQDL
RDKVVPLYDQPGATLFVSVYQ
Download sequence
Identical sequences B0BYH7
329726.AM1_0818 gi|158334004|ref|YP_001515176.1| WP_012161443.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]