SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334044|ref|YP_001515216.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334044|ref|YP_001515216.1|
Domain Number 1 Region: 19-251
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.01e-67
Family Alanine racemase-like, N-terminal domain 0.0000199
Further Details:      
 
Domain Number 2 Region: 245-380
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.37e-51
Family Alanine racemase 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334044|ref|YP_001515216.1|
Sequence length 386
Comment alanine racemase [Acaryochloris marina MBIC11017]
Sequence
MVKHASPGTLACERAWVNIDLKALENNVRQIKQQLLPQTALMAVVKADGYGHGAVTVAQT
ALANGATWLGVATILEGIELRQADINAPILILGATHTVQEIEAIVRWQLQPTLCSPEQAL
IFSRHLQHPLPIHLKVDTGMSRLGPIWQQGATFIEFVSRLPNLKIASIYSHLATADDADS
SFMLQQQSRLQDVLSRIQAQDIPLPKLHLANSAGTLVGPQFHYDLVRVGLALYGLYPAPH
FQQAIALQPVMQVKARITQIKTLPAGSGVSYNHTFTTEQPLTVAVVGIGYADGVPRSLSN
QMNVIIRGRLAPQIGAITMDQLMVDVSDVPNLQVGEVVTILGQDGKASISAETWADALGT
ISYEIVCGFKHRLPRILVNSDVPQRL
Download sequence
Identical sequences B0BYL7
gi|158334044|ref|YP_001515216.1| WP_012161477.1.67183 329726.AM1_0858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]