SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334081|ref|YP_001515253.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334081|ref|YP_001515253.1|
Domain Number 1 Region: 3-202,233-316
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 8.24e-88
Family ATP synthase (F1-ATPase), gamma subunit 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334081|ref|YP_001515253.1|
Sequence length 317
Comment F0F1 ATP synthase subunit gamma [Acaryochloris marina MBIC11017]
Sequence
MPNLKSIRDRISTVKNTKKITEAMRLVAAAKVRRAQEQVTATRPFADRLAQVLYGLQARL
KFEEVELPLLQERALRKVCLLVVTGDRGLCGAYNSSVIKRAEERSNELKAKGIDYTFVLV
GRKAIQYFQRRDQPIEATYGGLEQIPTAQEASEIADELLSLYLSEEVDHVELIYTRFISL
VNSRPVVQTLLPLDPDALVVAEEDEVFRLTTRGGQFQVERERMERGTPQEMPSDMIFEQN
PIQILDALLPLYLNNQLLRALQESAASELAARMTAMNNASDNASELIGTLTLSYNKARQA
AITQELLEVVGGAEALN
Download sequence
Identical sequences B0BZL3
WP_010468100.1.53659 WP_010468100.1.67183 329726.AM1_0897 gi|158334081|ref|YP_001515253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]