SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334147|ref|YP_001515319.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334147|ref|YP_001515319.1|
Domain Number 1 Region: 16-241
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.96e-87
Family Undecaprenyl diphosphate synthase 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158334147|ref|YP_001515319.1|
Sequence length 255
Comment undecaprenyl pyrophosphate synthase [Acaryochloris marina MBIC11017]
Sequence
MNNFDYVTRPTDLDPDCLPQHVAVIMDGNGRWAKRQGFPRIAGHRQGARTLKDLVRCCKD
WGIPTLTAYAFSTENWRRPLEEVDFLLVLFERLLRQELAEMDREGVRISFIGDLSPLPSS
LRKEIDRAVLATANNRAVHFNVAVNYGSRAELTQACRQIAEQVQLGNIEPGAVDEQLIEQ
YLYTAGTPDPDLLIRSSGELRLSNYLLWQLAYTEFYFTDVFWPDFDRAVFHEALQHYQMR
DRRFGTVKLKQPCAG
Download sequence
Identical sequences B0C0N1
WP_010477105.1.53659 WP_010477105.1.67183 gi|158334147|ref|YP_001515319.1| 329726.AM1_0963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]